Jobs on TAL
All jobsOnsiteEngineeringfintech3-5 yearsjava
OnsiteMid Levelfintech

Regular Java Fullstack Developer (Angular)

LuxoftBengaluru, Karnataka, IndiaPosted 20 May 2026

Luxoft is hiring a Fullstack Developer to build cloud-based compliance archive products for the financial sector. The role involves full-lifecycle development of Java microservices and Angular front-end components within an agile environment. Candidates must have solid experience with Java, Spring, microservices, and containerization. The team is focused on transitioning from project-based work to long-term product management.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

3-5 years

Function

Engineering

Work mode

Onsite, India

Company

Tier 2

What you will work on

Luxoft is hiring a Fullstack Developer to build cloud-based compliance archive products for the financial sector. The role involves full-lifecycle development of Java microservices and Angular front-end components within an agile environment. Candidates must have solid experience with Java, Spring, microservices, and containerization. The team is focused on transitioning from project-based work to long-term product management.

TAL's take

Quality 55/1005/5 clarityTier 2 company

Solid tier-2 professional services firm with a clearly defined technical role in the banking/compliance space.

Very well-defined requirements, technology stack, and responsibilities provided.

Salaries at Luxoft

25.8 LPA average

Based on 18 Grapevine salary entries for Luxoft.

View all salaries

Engineering

8 - 10 years

28 LPA average

Range: 28 - 28 LPA

Engineering

10 - 12 years

21 LPA average

Range: 20 - 22 LPA

Other roles

2 - 4 years | Consultant

7 LPA average

Range: 7 - 7 LPA

Human Resources

4 - 6 years | Consultant

6 LPA average

Range: 6 - 6 LPA

Must haves

  • 3-5 years of experience
  • Core Java, J2EE, and Angular expertise
  • Proficiency in Spring Framework and Microservices
  • Experience with Kafka or messaging systems
  • Knowledge of JPA, JTA, CDI APIs
  • Containerization tools like Docker or Kubernetes
  • Upper-Intermediate English proficiency

Tools and skills

javaj2eeangularspring frameworkmicroserviceskafkajpajtacdidockerkubernetesopenshiftmavengradlegitteamcityjenkins

Nice to have: banking domain.

About the company

Luxoft is a well-established global IT services and consulting firm, classified as tier 2 in the engineering space.

Posts mentioning Luxoft