Jobs on TAL
All jobsOnsiteEngineeringcybersecurityExperience not specifiedsplunk
OnsiteEntry Level/Juniorcybersecurity

L1 SOC Analyst

USTKochi, Kerala, IndiaPosted 20 May 2026

UST is hiring a SOC Analyst to join their Cyber Operations Department in Kochi. The role involves monitoring and analyzing security incidents to safeguard the organization's digital assets and infrastructure. Candidates must have experience with SIEM, EDR, DLP, and common security frameworks like NIST or ISO. This position offers exposure to multiple cybersecurity disciplines including threat intelligence and vulnerability management.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

Experience not specified

Function

Engineering

Work mode

Onsite, India

Company

Tier 2

What you will work on

UST is hiring a SOC Analyst to join their Cyber Operations Department in Kochi. The role involves monitoring and analyzing security incidents to safeguard the organization's digital assets and infrastructure. Candidates must have experience with SIEM, EDR, DLP, and common security frameworks like NIST or ISO. This position offers exposure to multiple cybersecurity disciplines including threat intelligence and vulnerability management.

TAL's take

Quality 50/1004/5 clarityTier 2 company

Solid tier-2 global firm with a defined security operations role, though seniority is entry-level and scope is standard.

Clear and coherent JD for a SOC analyst role with specific technology expectations aligned with the function.

Salaries at UST

20.9 LPA average

Based on 19 Grapevine salary entries for UST.

View all salaries

Other roles

0 - 2 years

5 LPA average

Range: 5 - 5 LPA

Other roles

2 - 4 years

7 LPA average

Range: 4 - 10 LPA

Other roles

4 - 6 years

54 LPA average

Range: 9 - 100 LPA

Other roles

6 - 8 years

7 LPA average

Range: 6 - 9 LPA

Must haves

  • Strong knowledge of SIEM tools like Splunk
  • Experience with AV/EDR tools like CrowdStrike and Windows Defender
  • Knowledge of DLP tools like Cyberhaven
  • Experience with information security technologies including Firewall, IPS, IDS, SIEM, EDR, CASB, AV, DLP
  • Understanding of security controls frameworks like ISO, NIST, CIS, or CSA

Tools and skills

splunkcrowdstrikewindows defendercyberhavensiemedrdlpfirewallipsidscasbav

About the company

Global IT services and digital transformation company with a significant established engineering presence.

Posts mentioning UST

Feeling lost after 3 years in Tech

Career Advice Needed Hi guys, I’m looking for some honest guidance from those who've been through tough phases in their careers. I joined UST straight after college. Out of my 2.5 years there, 6 months went into training, and I spent about a year on the bench. I finally got a project, worked for a few months, but then the project ended and everyone was released. A couple of months later, HR asked me to resign—basically a silent layoff. After serving my notice period, I joined a startup in Pune, hoping to turn things around. But it turned out to be a toxic environment with poor culture, no proper hardware or support, and unrealistic expectations. They expected me to perform like a senior developer with very little real experience. Eventually, I was put on a PIP and let go. Now I’m feeling overwhelmed. While I technically have 3 years of experience as a React developer, my actual hands-on exposure has been limited. I’ve lost confidence and I’m unsure of my next step. One thing I do know—I want to focus only on MNCs now. The startup culture just didn’t work for me. If anyone has faced something similar or has advice on how to bounce back, rebuild skills, and re-enter the job market stronger, I’d really appreciate your insights. Thanks in advance. Also if anyone can give me refferal it would be much helpful

Career Advice81

Infosys vs UST Global

Hi All, i would like to have your suggesstion between these two companies for experienced professional.

IT Company Discussion31

Need advice to select the right company

I want to know about the company @Capco. Current domain: Data Engg YOE: 4.7 CCTC: 16.4 Offer: 23(fixed)+1 JB Post: Sr Consultant 2 grade M2. I want to know about the company culture,WLB,job security,bench policy.Also,I am a bit confused.The role offered is for a consultant,but the questions were more oriented toward arch. There were no questions on PySpark.The manager said the work is on ETL migration for Barclays using AWS Glue and Spark,but no related questions.Should I take the offer or continue rounds with EPAM,UST,EY?

Company Reviews40