Jobs on TAL
All jobsOnsiteEngineeringenergy and industrial infrastructureExperience not specifiedinfoworks icm
OnsiteMid Levelenergy and industrial infrastructure

Associate - LDME

WSPBengaluru, Karnataka, IndiaPosted 17 May 2026

WSP is hiring an Associate Engineer in the water infrastructure domain in Bengaluru. The role involves performing hydrological analysis, hydraulic modelling, and designing infrastructure drainage and flood mitigation systems. Candidates must be proficient in industry-standard software like InfoWorks ICM, HecRAS, and ArcGIS for complex water resource projects. The position requires strong technical reporting skills and the ability to apply regulatory design standards.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

Experience not specified

Function

Engineering

Work mode

Onsite, India

Company

Tier 2

What you will work on

WSP is hiring an Associate Engineer in the water infrastructure domain in Bengaluru. The role involves performing hydrological analysis, hydraulic modelling, and designing infrastructure drainage and flood mitigation systems. Candidates must be proficient in industry-standard software like InfoWorks ICM, HecRAS, and ArcGIS for complex water resource projects. The position requires strong technical reporting skills and the ability to apply regulatory design standards.

TAL's take

Quality 60/1005/5 clarityTier 2 company

Solid role at a well-regarded global engineering consultancy with defined technical requirements.

The JD provides a highly specific list of technical software and engineering domains relevant to the role.

Salaries at WSP

7.0 LPA average

Based on 3 Grapevine salary entries for WSP.

View all salaries

Operations

0 - 2 years | Graduate

6 LPA average

Range: 6 - 6 LPA

Other roles

0 - 2 years | Graduate

3 LPA average

Range: 3 - 3 LPA

Other roles

4 - 6 years

12 LPA average

Range: 12 - 12 LPA

Must haves

  • Experience in computer aided design environment
  • 1D-2D hydraulic modelling
  • Flood risk assessments
  • Design of highway and infrastructure drainage works
  • Proficiency in hydrological and hydraulic modelling software
  • Ability to prepare and present technical reports in English

Tools and skills

infoworks icmhecrashechmshecsspwmshyfranarcgisqgisautocadcivil3dinfodrainagesewergemsstormcadculvertmasterflowmasterhy-8ms office suite

About the company

WSP is an established global engineering consultancy firm.