Jobs on TAL
All jobsOnsiteEngineeringenergy and industrial infrastructure3+ yearsnode.js
OnsiteMid Levelenergy and industrial infrastructure

Software Engineer

Baker HughesMumbai, IndiaPosted 20 May 2026

Baker Hughes is seeking a Software Engineer to join their Digital Solutions team, focusing on intelligent energy technology. The role involves full-stack development, designing modular enterprise-scale software, and managing API-based microservices architecture. Candidates should be proficient in modern web stacks including Node.js, .net, Python, and cloud platforms like AWS or Azure. The position emphasizes scalable, maintainable code within the energy domain.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

3+ years

Function

Engineering

Work mode

Onsite, India

Company

Tier 2

What you will work on

Baker Hughes is seeking a Software Engineer to join their Digital Solutions team, focusing on intelligent energy technology. The role involves full-stack development, designing modular enterprise-scale software, and managing API-based microservices architecture. Candidates should be proficient in modern web stacks including Node.js, .net, Python, and cloud platforms like AWS or Azure. The position emphasizes scalable, maintainable code within the energy domain.

TAL's take

Quality 60/1004/5 clarityTier 2 company

Solid tier-2 role at a large global industrial company with clear, defined scope for an experienced software engineer.

Well-defined responsibilities and comprehensive tech stack requirements despite the general title.

Salaries at Baker Hughes

19.8 LPA average

Based on 23 Grapevine salary entries for Baker Hughes.

View all salaries

Engineering

0 - 2 years | 1

10 LPA average

Range: 10 - 10 LPA

Engineering

14 - 16 years

33 LPA average

Range: 33 - 33 LPA

Other roles

0 - 2 years | 1

9 LPA average

Range: 5 - 12 LPA

Other roles

2 - 4 years | PB2

13 LPA average

Range: 6 - 20 LPA

Must haves

  • 3+ years of hands-on full stack development
  • Experience in node.js, .net, python
  • Proficiency in frontend frameworks like angular or react
  • Experience designing and developing RESTful services
  • Experience with microservices and docker containerization
  • Degree in Computer Science or STEM majors

Tools and skills

node.js.netpythonangularreactjavascripttypescripthtmlcssmysqlpostgresqlrestxmljsonapi gatewaymicroservicesdockerazureaws

Nice to have: rabbitmq, kafka, material ui, bootstrap.

About the company

Global energy technology company, established market presence but not a top-tier tech-native firm.

Posts mentioning Baker Hughes