Jobs on TAL
All jobsOnsiteQuality Assuranceai/ml infraExperience not specifiedpython
OnsiteMid Levelai/ml infra

AI/ML Testing Engineer

Tata ELXSIBengaluru, Karnataka, IndiaPosted 18 May 2026

Tata ELXSI is seeking an AI Quality Engineer to validate cutting-edge AI solutions including generative, conversational, and predictive models. The role involves end-to-end testing of ML models, utilizing Python, pandas, and scikit-learn for performance and output validation. Candidates will work with AI APIs, cloud deployments like AWS SageMaker, and production lifecycle monitoring. This position requires strong analytical skills to ensure model reliability and fairness across diverse AI applications.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

Experience not specified

Function

Quality Assurance

Work mode

Onsite, India

Company

Tier 2

What you will work on

Tata ELXSI is seeking an AI Quality Engineer to validate cutting-edge AI solutions including generative, conversational, and predictive models. The role involves end-to-end testing of ML models, utilizing Python, pandas, and scikit-learn for performance and output validation. Candidates will work with AI APIs, cloud deployments like AWS SageMaker, and production lifecycle monitoring. This position requires strong analytical skills to ensure model reliability and fairness across diverse AI applications.

TAL's take

Quality 60/1005/5 clarityTier 2 company

Solid tier-2 engineering services firm offering a well-defined role in the specialized AI quality assurance domain.

Highly specific requirements focusing on AI/ML model validation, Python-based test automation, and ML lifecycle testing.

Salaries at Tata ELXSI

10.0 LPA average

Based on 89 Grapevine salary entries for Tata ELXSI.

View all salaries

Engineering

0 - 2 years | L1

5 LPA average

Range: 3 - 7 LPA

Other roles

0 - 2 years | L1

3 LPA average

Range: 3 - 5 LPA

Operations

2 - 4 years | Engineer

6 LPA average

Range: 6 - 7 LPA

Design

2 - 4 years | Engineer

4 LPA average

Range: 4 - 4 LPA

Must haves

  • Testing and validating AI/ML solutions (Generative AI, Conversational AI, Predictive models)
  • Understanding of ML model lifecycle (data prep to tuning)
  • Proficiency in Python for automation and data validation
  • Hands-on experience with pandas, NumPy, and scikit-learn
  • Experience testing AI APIs (FastAPI, Flask)
  • Knowledge of AWS SageMaker
  • Understanding of model evaluation metrics and production monitoring

Tools and skills

pythonpandasnumpyscikit-learnfastapiflaskaws sagemaker

Nice to have: generative ai, mlops, ci/cd, responsible ai.

About the company

Established global engineering and design services company with a focus on product engineering.

Posts mentioning Tata ELXSI