Jobs on TAL
All jobsHybridEngineeringb2b saas8+ yearsreactjs
HybridSeniorb2b saas

Senior Software Engineer – ReactJS, Automation Tester

D4 InsightChennai, IndiaPosted 20 May 2026

D4 Insight is seeking a Senior Software Engineer for their Chennai office to focus on enterprise frontend development and automation testing. The role involves building scalable ReactJS components, implementing robust test frameworks, and optimizing UI performance. Candidates must have extensive experience with the React ecosystem and deep domain knowledge in banking or retail. This position operates in a hybrid delivery model within an Agile environment.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

8+ years

Function

Engineering

Work mode

Hybrid, India

Company

Tier 2

What you will work on

D4 Insight is seeking a Senior Software Engineer for their Chennai office to focus on enterprise frontend development and automation testing. The role involves building scalable ReactJS components, implementing robust test frameworks, and optimizing UI performance. Candidates must have extensive experience with the React ecosystem and deep domain knowledge in banking or retail. This position operates in a hybrid delivery model within an Agile environment.

TAL's take

Quality 55/1004/5 clarityTier 2 company

Solid mid-tier role with clear responsibilities and seniority expectations, though company status is unverified.

Clear expectations and stack, though the combination of frontend development and automation testing is slightly broad.

Must haves

  • Strong expertise in ReactJS, JavaScript, and TypeScript
  • Experience with automation scripting and testing tools
  • Proficiency in Redux, Hooks, and Context API
  • Mandatory experience in Banking or Retail domain
  • Ability to work with CI/CD and REST APIs

Tools and skills

reactjsjavascripttypescripthtmltailwind cssreduxhookscontext apijesteslintautomation scriptingtesting frameworks

Nice to have: angular.

About the company

Unfamiliar company, default mid-tier assigned.