Jobs on TAL
All jobsOnsiteEngineeringautomotive2-3 yearscreo
OnsiteMid Levelautomotive

Engineer - Transmission Components Design & VAVE

EatonPune, Maharashtra, IndiaPosted 20 May 2026

Eaton is seeking a mechanical design engineer for its Mobility Group based in Pune, focused on the design and validation of automotive transmission components. You will drive product design changes, manage VAVE cost-out initiatives, and perform detailed design calculations using Creo. The role requires application of DFSS, DFMA, and FEA methodologies to ensure product quality and performance. This is a technical IC position working within a global cross-functional team.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

2-3 years

Function

Engineering

Work mode

Onsite, India

Company

Tier 2

What you will work on

Eaton is seeking a mechanical design engineer for its Mobility Group based in Pune, focused on the design and validation of automotive transmission components. You will drive product design changes, manage VAVE cost-out initiatives, and perform detailed design calculations using Creo. The role requires application of DFSS, DFMA, and FEA methodologies to ensure product quality and performance. This is a technical IC position working within a global cross-functional team.

TAL's take

Quality 60/1005/5 clarityTier 2 company

Solid engineering role at a large, established global industrial firm with clearly defined technical responsibilities.

Very well-defined responsibilities, specific CAD/technical stack, and clear domain focus on transmission components.

Salaries at Eaton

22.2 LPA average

Based on 12 Grapevine salary entries for Eaton.

View all salaries

Engineering

4 - 6 years | L1

29 LPA average

Range: 29 - 29 LPA

Engineering

6 - 8 years | L1

23 LPA average

Range: 23 - 23 LPA

Engineering

8 - 10 years

24 LPA average

Range: 24 - 24 LPA

Other roles

2 - 4 years | 8

3 LPA average

Range: 3 - 3 LPA

Must haves

  • Design and validation of transmission components
  • Proven track record in VAVE and costout projects
  • Proficiency in Creo CAD tool
  • Proficiency in GD&T and tolerance stack up analysis
  • Bachelor with 3+ years or Master with 2+ years of experience

Tools and skills

creogd&ttolerance stack up analysisfeaplmdfssdfmadfmeadvprvave

About the company

Global industrial power management company with a significant established engineering footprint in India.

Posts mentioning Eaton