Jobs on TAL
All jobsHybridEngineeringenergy and industrial infrastructure5+ yearsmes
HybridSeniorenergy and industrial infrastructure

MES Operations Engineer

Be a CatalystBengaluru, Karnataka, IndiaPosted 20 May 2026

Be a Catalyst is hiring an MES Operations Engineer to manage production support within manufacturing environments. The role involves maintaining microservices architecture, monitoring systems with ELK and Grafana, and managing Kubernetes-based infrastructure. Candidates must have strong troubleshooting skills and experience with enterprise tools like SAP and ServiceNow. The position is based in Bengaluru and requires collaboration with global stakeholders.

Matched by TAL

50k new jobs listed every day. Install TAL to find more jobs like this.

Install TAL

Experience

5+ years

Function

Engineering

Work mode

Hybrid, India

Company

Tier 2

What you will work on

Be a Catalyst is hiring an MES Operations Engineer to manage production support within manufacturing environments. The role involves maintaining microservices architecture, monitoring systems with ELK and Grafana, and managing Kubernetes-based infrastructure. Candidates must have strong troubleshooting skills and experience with enterprise tools like SAP and ServiceNow. The position is based in Bengaluru and requires collaboration with global stakeholders.

TAL's take

Quality 50/1004/5 clarityTier 2 company

Solid role scope and clear technical requirements, but the company is unfamiliar and the JD is quite generic in its manufacturing focus.

Clear technical expectations and responsibilities aligned with a support/operations focus in a specific domain.

Must haves

  • Strong MES domain expertise with manufacturing background
  • Experience in microservices and enterprise production support
  • Hands-on experience with ELK, Grafana, and APM tools
  • Experience with Kubernetes, Docker, Mirantis, Rancher, and GitHub
  • Strong troubleshooting and debugging capabilities

Tools and skills

mesmicroserviceselkgrafanaapmapisswaggerkafkasap s/4hanakubernetesdockermirantisranchergithubservicenowsmttroubleshooting

Nice to have: c#, pl/sql, jira, confluence.

About the company

unfamiliar company, default mid-tier

Posts mentioning Be a Catalyst